PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK17744.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family CO-like
Protein Properties Length: 473aa    MW: 51561.4 Da    PI: 5.2506
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK17744.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box20.88e-071352437
   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......H 37
                 C+ ++e+ + lfC+ ++  lC  C ++ H+       H
  PK17744.1 13 VPCDFCSEQVAVLFCRADSAKLCLFCDQHVHSAnllsrkH 52
               67***************************99545555555 PP

2zf-B_box18.64e-065597339
   zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg.......Htv 39
                ++C+++++++++  C + +  lC+dC    H g       H++
  PK17744.1 55 SQICDNCGSEPVSVRCSTENLVLCHDCDWDAH-GtcsvspaHER 97
               579************************99989.54667777765 PP

3CCT63.66.1e-22424467144
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                R +a++RYkeK+k+R+++K+irYesRKa+A++R+RvKGrFvk+a
  PK17744.1 424 RGNAMQRYKEKKKNRRYDKHIRYESRKARADTRKRVKGRFVKAA 467
                7789**************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.6E-121057IPR000315B-box-type zinc finger
PROSITE profilePS501199.5131057IPR000315B-box-type zinc finger
CDDcd000212.08E-71345No hitNo description
PROSITE profilePS501198.74553100IPR000315B-box-type zinc finger
CDDcd000211.61E-65793No hitNo description
SMARTSM003364.958100IPR000315B-box-type zinc finger
PfamPF062032.6E-16424466IPR010402CCT domain
PROSITE profilePS5101714.902424466IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MVNSPRSRTG NSVPCDFCSE QVAVLFCRAD SAKLCLFCDQ HVHSANLLSR KHLRSQICDN  60
CGSEPVSVRC STENLVLCHD CDWDAHGTCS VSPAHERNSV DGFSGCPSAL ELASVWGFHL  120
GEKKSGRPDS TVQNYELGMA MPEAEDTSWS GVNFQDLIVP TGNGLVGEEG KKQSGMGVSC  180
CGKKKQVMYK QLVELLKRDL VAPENDEFGD DGCGGDNGCS GGGVVESLMP ENSYRSSWQR  240
NAEAALSLGD GCDAVDDVAF AAQPSSTPFT SLLMMPMHCE LKENDGIDDG DLAMWDTNPN  300
GPTTQIWDFH SGRLRVNEEP EISYGANDGG FMIKNFCDLL NCPVAPDDMT INNSSQGAAT  360
SESNNLPIGK GSSSSTSALG KHKNEECSAS REVYFMEQPF LVRNDTMKTG ATSKEELEVL  420
AHNRGNAMQR YKEKKKNRRY DKHIRYESRK ARADTRKRVK GRFVKAAEAA PDG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015902288.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 15
TrEMBLM5XDL71e-166M5XDL7_PRUPE; Uncharacterized protein
STRINGVIT_01s0146g00360.t011e-147(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47372843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33500.11e-104B-box type zinc finger protein with CCT domain